MGC27016 (N-Term) anticorps

N° du produit ABIN633549

Cet anticorps anti- est un anticorps Lapin Polyclonal détectant dans IHC et WB. Adapté pour Chien, Humain, Souris et Rat.

Aperçu rapide pour MGC27016 (N-Term) anticorps (ABIN633549)

Antigène: MGC27016

Reactivité: Chien, Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: MGC27016 antibody was raised against the N terminal of MGC27016

Purification: Affinity purified

Immunogène: MGC27016 antibody was raised using the N terminal of MGC27016 corresponding to a region with amino acids LNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVD

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGC27016 Blocking Peptide, (ABIN5614744), is also available for use as a blocking control in assays to test for specificity of this MGC27016 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC27016 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: MGC27016

Sujet: MGC27016 is involved in pseudouridine synthase activity and RNA binding.

Poids moléculaire: 59 kDa (MW of target protein)